Uap1 antibody

• Catalog Number: orb580674
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Uap1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat, Yeast, Zebrafish
• Reactivity: Mouse
• Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 59 kDa
• Target: Uap1
• UniProt ID: Q91YN5
• Protein Sequence: Synthetic peptide located within the following region: LKDANDVPIQCEISPLISYAGEGLEGYVADKEFHAPLIIDENGVHELVKN
• NCBI: NP_598567
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: Ag, SP, AgX, AGX1, AGX-1, AGX-2, ESTM3, SPAG2, EST
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. An isoform containing the peptide sequence is present at 42 kDa.

Host: Rabbit, Target Name: UAP1L1, Sample Tissue: Mouse Brain, Antibody dilution: 1 ug/ml.

Host: Rabbit, Target Name: UAP1L1, Sample Tissue: Mouse Brain, Antibody dilution: 1 ug/ml.

Host: Rabbit, Target Name: UAP1L1, Sample Tissue: Mouse Brain, Antibody dilution: 1 ug/ml.

Host: Rabbit, Target Name: UAP1L1, Sample Tissue: Mouse Testis, Antibody dilution: 3 ug/ml.

WB Suggested Anti-Uap1 Antibody, Titration: 1.0 ug/ml, Positive Control: Mouse Brain.