TWIST1 antibody

• Catalog Number: orb329955
• Category: Antibodies
• Description: Rabbit polyclonal antibody to TWIST1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human TWIST1
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 21kDa
• Target: TWIST1
• UniProt ID: Q15672
• Protein Sequence: Synthetic peptide located within the following region: DKLSKIQTLKLAARYIDFLYQVLQSDELDSKMASCSYVAHERLSYAFSVW
• NCBI: NP_000465
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti SCS antibody, anti ACS3 antibody, anti CRS1 a
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

References

Armando, Federico et al. Epithelial to Mesenchymal Transition (EMT) in a Laryngeal Squamous Cell Carcinoma of a Horse: Future Perspectives Animals (Basel), 10, E2318 (2020)

PubMed: 33297475

Immunohistochemical staining of human Uterus tissue using TWIST1 antibody

Western blot analysis of Jurkat tissue using TWIST1 antibody

Western blot analysis of Jurkat cell lysate tissue using TWIST1 antibody

Host: Rabbit, Target Name: TWIST1, Sample Type: Jurkat, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 2.5 ug/mL, Peptide Concentration: 2.0 ug/mL, Lysate Quantity: 25 ug/lane, Gel Concentration: 12%.

Host: Rabbit, Target: TWIST1, Positive control (+): A549 (N03), Negative control (-): U937 (N31), Antibody concentration: 1 ug/mL.

Uterus

WB Suggested Anti-TWIST1 Antibody Titration: 2.5 ug/mL, ELISA Titer: 1:1562500, Positive Control: Jurkat cell lysate.