TUBA3C antibody

• Catalog Number: orb582166
• Category: Antibodies
• Description: Rabbit polyclonal antibody to TUBA3C
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Mouse, Porcine, Rabbit, Rat, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TUBA3C
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 50kDa
• Target: TUBA3C
• UniProt ID: Q13748
• Protein Sequence: Synthetic peptide located within the following region: VDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDL
• NCBI: NP_005992
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: TUBA2, bA408E5.3
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. The peptide is present in several isoforms including 37 kDa, 43 kDa and 50 kDa. The protein may be modified by tyrosine nitrosylation, phosphorylation and/or acetylation.

Host: Rabbit, Target Name: TUBA3C, Sample Type: Hela, Antibody dilution: 1.0 ug/ml. TUBA3C is supported by BioGPS gene expression data to be expressed in HeLa.

Host: Rabbit, Target Name: TUBA3C, Sample Type: Jurkat, Antibody dilution: 1.0 ug/ml. TUBA3C is supported by BioGPS gene expression data to be expressed in Jurkat.

WB Suggested Anti-TUBA3C Antibody Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate.