TSHR antibody

• Catalog Number: orb578254
• Category: Antibodies
• Description: Rabbit polyclonal antibody to TSHR
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human TSHR
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 87 kDa
• Target: TSHR
• UniProt ID: Q96GT6
• Protein Sequence: Synthetic peptide located within the following region: KLDAVYLNKNKYLTVIDKDAFGGVYSGPSLLLPLGRKSLSFETQKAPRSS
• NCBI: NP_001018046
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: LGR3, CHNG1, hTSHR-I
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. The peptide sequence is present in a 28 kDa isoform. The protein may be modified by glycosylation.

Host: Rabbit, Target Name: TSHR, Sample Tissue: Human HepG2 Whole Cell, Antibody Dilution: 1 ug/ml.

WB Suggested Anti-TSHR Antibody Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate. There is BioGPS gene expression data showing that TSHR is expressed in Jurkat. The peptide sequence is present in a 28 kDa isoform.