You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb578253 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to TSHR |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Mouse, Rabbit, Rat, Sheep |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human TSHR |
Concentration | 1.0 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 87 kDa |
Target | TSHR |
UniProt ID | Q96GT6 |
Protein Sequence | Synthetic peptide located within the following region: CHQEEDFRVTCKDIQRIPSLPPSTQTLKLIETHLRTIPSHAFSNLPNISR |
NCBI | NP_001018046 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | LGR3, CHNG1, hTSHR-I Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. The peptide is present in isoforms of 87, 31 and 28 kDa. Only the 28 kDa isoform is detected in these samples.
Host: Rabbit, Target Name: TSHR, Sample Type: Jurkat, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 2.5 ug/ml, Peptide Concentration: 2.0 ug/ml, Lysate Quantity: 25 ug/lane, Gel Concentration: 12%. There is BioGPS gene expression data showing that TSHR is expressed in Jurkat.
WB Suggested Anti-TSHR Antibody Titration: 1.25 ug/ml, Positive Control: Jurkat cell lysate. There is BioGPS gene expression data showing that TSHR is expressed in Jurkat.
WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating