You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb576274 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to TSG101 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Goat, Guinea pig, Human, Rabbit, Rat |
Reactivity | Mouse |
Immunogen | The immunogen is a synthetic peptide corresponding to a region of Mouse |
Concentration | 1.0 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 43kDa |
Target | TSG101 |
UniProt ID | Q61187 |
Protein Sequence | Synthetic peptide located within the following region: RSELLELIQIMIVIFGEEPPVFSRPTVSASYPPYTATGPPNTSYMPGMPS |
NCBI | NP_068684 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | CC2, AI255943 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Sample Type: mouse fibroblast lusate (10 ug), Primary Dilution: 1:1000 (1% BSA), Secondary Dilution: 1:2000 (5% milk).
Rabbit Anti-Tsg101 Antibody, Paraffin Embedded Tissue: Mouse Kidney, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.
WB Suggested Anti-TSG101 Antibody, Positive Control: Lane 1: 30 ug mouse brain lysate, Lane 2: 30 ug mouse brain lysate, Lane 3: 30 ug mouse brain lysate, Primary Antibody Dilution: 1:1000, Secondary Antibody: Goat anti-rabbit-HRP, Secondry Antibody Dilution: 1:50000.
WB Suggested Anti-TSG101 Antibody Titration: 1.25 ug/ml, Positive Control: NIH/3T3 cell lysate.
IHC-P, WB | |
Bovine, Canine, Equine, Mouse, Rabbit | |
Human, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IH, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ICC, IHC-Fr, IHC-P, WB | |
Human, Mouse, Rat | |
Rabbit | |
Monoclonal | |
Unconjugated |
Filter by Rating