You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb575431 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to Trpv6 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Canine, Equine, Guinea pig, Mouse, Rabbit |
Reactivity | Human, Rat |
Immunogen | The immunogen is a synthetic peptide corresponding to a region of Rat |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 83kDa |
Target | Trpv6 |
UniProt ID | Q9R186 |
Protein Sequence | Synthetic peptide located within the following region: TEIDSSGDDQSLLELIVTTKKREARQILDQTPVKELVSLKWKRYGRPYFC |
NCBI | NP_446138 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | CaT1, Ecac2, Otrpc3 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Sample Type: hRetinal pigment epithelial cells, 4 individual donors (20 ug), Primary dilution: 1:1000, Secondary Antibody: goat anti-rabbit-AP, Secondary dilution: 1:2000.
Sample Type: hRetinal pigment epithelial cells, Green: primary, Red: nuclear, Primary dilution: 1:200, Secondary Antibody: goat anti-rabbit-Alexa 488, Secondary dilution: 1:500.
Host: Rabbit, Target Name: TRPV6, Sample Tissue: Human Hela Whole Cell, Antibody dilution: 1 ug/ml.
Host: Rabbit, Target Name: TRPV6, Sample Tissue: Human Hela Whole Cell, Antibody dilution: 2 ug/ml.
Trpv6 antibody - middle region (orb575431) validated by WB using Rat Brain lysate at 1 ug/ml.
Filter by Rating