TRPV5 Rabbit Polyclonal Antibody

• Catalog Number: orb330584
• Category: Antibodies
• Description: Rabbit polyclonal antibody to TRPV5
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TRPV5
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 82kDa
• Target: TRPV5
• UniProt ID: Q9NQA5
• Protein Sequence: Synthetic peptide located within the following region: MLQQKRILESPLLRASKENDLSVLRQLLLDCTCDVRQRGALGETALHIAA
• NCBI: NP_062815
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti CAT2 antibody, anti ECAC1 antibody, anti OTRP
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Type: 1-4. hRetinal pigment epithelial cells, 4 individual donors (20 ug), Primary dilution: 1:1000, Secondary Antibody: goat anti-rabbit-AP, Secondary dilution: 1:2000.

Sample Type: hRetinal pigment epithelial cells, Green: primary, Red: nuclear, Primary dilution: 1:200, Secondary Antibody: goat anti-rabbit-Alexa 488, Secondary dilution: 1:500.

WB Suggested Anti-TRPV5 Antibody Titration: 0.2-1 ug/ml, Positive Control: 721_B cell lysate, TRPV5 is supported by BioGPS gene expression data to be expressed in 721_B.