TRPV4 Rabbit Polyclonal Antibody

• Catalog Number: orb575481
• Category: Antibodies
• Description: Rabbit polyclonal antibody to TRPV4
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Guinea pig, Mouse, Porcine, Rabbit
• Reactivity: Human, Rat
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TRPV4
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 98 kDa
• Target: TRPV4
• UniProt ID: Q9HBA0
• Protein Sequence: Synthetic peptide located within the following region: RVDEVNWSHWNQNLGIINEDPGKNETYQYYGFSHTVGRLRRDRWSSVVPR
• NCBI: NP_671737
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: SMAL, VRL2, BCYM3, CMT2C, SPSMA, TRP12, VROAC, HMS
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 0.3 ug/ml of the antibody was used in this experiment. Isoform 2 is identified as 91 kDa, the canonical 98 kDa from can be observed in some samples, and several isoforms of this protein contain the immunizing peptide including a 60 kDa form.

Sample Tissue: Human THP-1 Whole Cell, Antibody dilution: 1 ug/ml.

Sample Type: HT1080, Antibody dilution: 1.0 ug/ml.

Sample Type: PANC1, Antibody dilution: 1.0 ug/ml. TRPV4 is supported by BioGPS gene expression data to be expressed in PANC1.

Rat Hippocamus

WB Suggested Anti-TRPV4 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: HT1080 cell lysate.