TRPV4 Rabbit Polyclonal Antibody

• Catalog Number: orb575445
• Category: Antibodies
• Description: Rabbit polyclonal antibody to TRPV4
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Guinea pig, Mouse, Porcine, Rabbit
• Reactivity: Human, Rat
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TRPV4
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 91kDa
• Target: TRPV4
• UniProt ID: Q9HBA0
• Protein Sequence: Synthetic peptide located within the following region: RVDEVNWSHWNQNLGIINEDPGKNETYQYYGFSHTVGRLRRDRWSSVVPR
• NCBI: NP_671737
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: SMAL, VRL2, BCYM3, CMT2C, SPSMA, TRP12, VROAC, HMS
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

TRPV4 Rat Hippocampus We tested the antibodies in Immunohistochemistry studies. The dilutions for all the above primary antibodies were 1:500 and the same for the secondary antibody, Alexa Fluor 568-conjugated goat anti-rabbit antibodies (Invitrogen).

WB Suggested Anti-TRPV4 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:12500, Positive Control: ACHN cell lysate.