TRPM8 Rabbit Polyclonal Antibody

• Catalog Number: orb329829
• Category: Antibodies
• Description: Rabbit polyclonal antibody to TRPM8
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TRPM8
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 128 kDa
• Target: TRPM8
• UniProt ID: Q7Z2W7
• Protein Sequence: Synthetic peptide located within the following region: YILDNNHTHLLLVDNGCHGHPTVEAKLRNQLEKYISERTIQDSNYGGKIP
• NCBI: NP_076985
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti LTRPC6 antibody, anti MGC2849 antibody, anti
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 0.5 ug/mL of the antibody was used in this experiment. An isoform containing the peptide sequence is present at ~19 kDa.

Sample Tissue: Human 293T Whole Cell, Antibody Dilution: 1 ug/mL.

Immunohistochemistry with Prostate tissue at an antibody concentration of 5 ug/mL using anti-TRPM8 antibody (orb329829).

WB Suggested Anti-TRPM8 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: ACHN cell lysate.