You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb329829 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to TRPM8 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human TRPM8 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 128 kDa |
Target | TRPM8 |
UniProt ID | Q7Z2W7 |
Protein Sequence | Synthetic peptide located within the following region: YILDNNHTHLLLVDNGCHGHPTVEAKLRNQLEKYISERTIQDSNYGGKIP |
NCBI | NP_076985 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti LTRPC6 antibody, anti MGC2849 antibody, anti Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 0.5 ug/mL of the antibody was used in this experiment. An isoform containing the peptide sequence is present at ~19 kDa.
Host: Rabbit, Target Name: TRPM8, Sample Tissue: Human 293T Whole Cell, Antibody Dilution: 1 ug/mL.
Immunohistochemistry with Prostate tissue at an antibody concentration of 5 ug/mL using anti-TRPM8 antibody (orb329829).
WB Suggested Anti-TRPM8 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: ACHN cell lysate.
Filter by Rating