TRPM4 antibody

Catalog Number: orb575427

Catalog Number	orb575427
Category	Antibodies
Description	Rabbit polyclonal antibody to TRPM4
Species/Host	Rabbit
Clonality	Polyclonal
Tested applications	WB
Predicted Reactivity	Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rat
Reactivity	Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rat
Immunogen	The immunogen is a synthetic peptide directed towards the N terminal region of human TRPM4
Concentration	0.5 mg/ml
Form/Appearance	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
MW	134 kDa
Target	TRPM4
UniProt ID	Q8TD43
Protein Sequence	Synthetic peptide located within the following region: ELLTVYSSEDGSEEFETIVLKALVKACGSSEASAYLDELRLAVAWNRVDI
NCBI	NP_060106
Storage	Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/Preservatives	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Alternative names	EKVP6, LTrpC4, PFHB1B, TRPM4B, hTRPM4 Read more...
Note	For research use only
Expiration Date	12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 2 ug/ml of the antibody was used in this experiment.

Host: Rabbit, Target Name: TRPM4, Sample Type: 293T, Antibody dilution: 1.0 ug/ml.

Host: Rabbit, Target Name: TRPM4, Sample Type: 721_B, Antibody dilution: 1.0 ug/ml.

Host: Rabbit, Target Name: TRPM4, Sample Type: Hela, Antibody dilution: 1.0 ug/ml.

Host: Rabbit, Target Name: TRPM4, Sample Type: HepG2, Antibody dilution: 1.0 ug/ml.

Host: Rabbit, Target Name: TRPM4, Sample Type: Jurkat, Antibody dilution: 1.0 ug/ml.

Host: Rabbit, Target Name: TRPM4, Sample Type: MCF7, Antibody dilution: 1.0 ug/ml.

Host: Rat, Target Name: TRPM4, Sample Tissue: Rat Brain, Antibody dilution: 1 ug/ml.

WB Suggested Anti-TRPM4 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: 293T cell lysate.