You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb575427 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to TRPM4 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rat |
Reactivity | Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rat |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human TRPM4 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 134 kDa |
Target | TRPM4 |
UniProt ID | Q8TD43 |
Protein Sequence | Synthetic peptide located within the following region: ELLTVYSSEDGSEEFETIVLKALVKACGSSEASAYLDELRLAVAWNRVDI |
NCBI | NP_060106 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | EKVP6, LTrpC4, PFHB1B, TRPM4B, hTRPM4 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 2 ug/ml of the antibody was used in this experiment.
Host: Rabbit, Target Name: TRPM4, Sample Type: 293T, Antibody dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: TRPM4, Sample Type: 721_B, Antibody dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: TRPM4, Sample Type: Hela, Antibody dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: TRPM4, Sample Type: HepG2, Antibody dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: TRPM4, Sample Type: Jurkat, Antibody dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: TRPM4, Sample Type: MCF7, Antibody dilution: 1.0 ug/ml.
Host: Rat, Target Name: TRPM4, Sample Tissue: Rat Brain, Antibody dilution: 1 ug/ml.
WB Suggested Anti-TRPM4 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: 293T cell lysate.
IH, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating