TRPC4 antibody

• Catalog Number: orb329823
• Category: Antibodies
• Description: Rabbit polyclonal antibody to TRPC4
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TRPC4
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 112kDa
• Target: TRPC4
• UniProt ID: Q9UBN4
• Protein Sequence: Synthetic peptide located within the following region: CPFKSEKVVVEDTVPIIPKEKHAKEEDSSIDYDLNLPDTVTHEDYVTTRL
• NCBI: NP_057263
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti HTRP4 antibody, anti MGC119570 antibody, anti
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Host: Rabbit, Target Name: TRPC4, Sample Tissue: Human 293T, Antibody Dilution: 1.0 ug/mL.

Host: Rabbit, Target Name: TRPC4, Sample Type: HepG2, Antibody Dilution: 1.0 ug/mL.

Host: Rabbit, Target Name: TRPC4, Sample Type: MCF7, Antibody Dilution: 1.0 ug/mL.

Host: Rabbit, Target: TRPC4, Positive control (+): Mouse pancreas (M-PA), Negative control (-): Human intestine (IN), Antibody concentration: 1 ug/mL.

Immunohistochemistry with Placenta tissue at an antibody concentration of 5 ug/mL using anti-TRPC4 antibody (orb329823).

WB Suggested Anti-TRPC4 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: 293T cell lysate.