Cart summary

You have no items in your shopping cart.

    TRMT9B Peptide - N-terminal region

    TRMT9B Peptide - N-terminal region

    Catalog Number: orb2001866

    DispatchUsually dispatched within 5-10 working days
    $ 284.00
    Catalog Numberorb2001866
    CategoryProteins
    DescriptionThis is a synthetic peptide designed for use in combination with anti-K1456 Antibody (ARP57469_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details.
    Form/AppearanceLyophilized powder
    MW49kDa
    UniProt IDQ9P272
    Protein SequenceSynthetic peptide located within the following region: CGTGKYLKVNSQVHTVGCDYCGPLVEIARNRGCEAMVCDNLNLPFRDEGF
    NCBIXP_006716434
    StorageAdd 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
    Buffer/PreservativesLyophilized powder
    Alternative namesTRM9L, hTRM9L, C8orf79, KIAA1456
    Read more...
    NoteFor research use only
    Expiration Date6 months from date of receipt.
    Submit a review

    Filter by Rating

      • Star
      • Star
      • Star
      • Star
      • Star
      • 5 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 4 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 3 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 2 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 1 stars