TRIM5 antibody

• Catalog Number: orb577266
• Category: Antibodies
• Description: Rabbit polyclonal antibody to TRIM5
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Human
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TRIM5
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 56kDa
• Target: TRIM5
• UniProt ID: Q9C035
• Protein Sequence: Synthetic peptide located within the following region: CQACLTANHKKSMLDKGESSCPVCRISYQPENIRPNRHVANLVEKLREVK
• NCBI: NP_149023
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: RNF88, TRIM5alpha
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Host: Rabbit, Target Name: CHAD, Sample Type: Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.

Host: Rabbit, Target Name: TRIM5, Sample Type: Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.

Host: Rabbit, Target Name: TRIM5, Sample Type: Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.

Host: Rabbit, Target Name: TRIM5, Sample Type: Human Fetal Muscle, Antibody Dilution: 1.0 ug/ml.

WB Suggested Anti-TRIM5 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: PANC1 cell lysate. TRIM5 is supported by BioGPS gene expression data to be expressed in PANC1.