You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb575246 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to TRIM39 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat |
Reactivity | Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rat |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human TRIM39 |
Concentration | 1.0 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 60 kDa |
Target | TRIM39 |
UniProt ID | Q5STG4 |
Protein Sequence | Synthetic peptide located within the following region: HTVVPLDDATQEYKEKLQKCLEPLEQKLQEITRCKSSEEKKPGELKRLVE |
NCBI | NP_742013 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | TFP, RNF23, TRIM39B Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. The peptide sequence is present in a 56 kDa isoform.
WB Suggested Anti-TRIM39 Antibody Titration: 1.25 ug/ml, ELISA Titer: 1:12500, Positive Control: HepG2 cell lysate, TRIM39 is supported by BioGPS gene expression data to be expressed in HepG2.
IHC, WB | |
Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat | |
Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating