You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb575215 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to TRIM10 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Human |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human TRIM10 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 55kDa |
Target | TRIM10 |
UniProt ID | Q9UDY6 |
Protein Sequence | Synthetic peptide located within the following region: PNWQLANVVENIERLQLVSTLGLGEEDVCQEHGEKIYFFCEDDEMQLCVV |
NCBI | NP_006769 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | RNF9, HERF1, RFB30 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Rabbit Anti-TRIM10 Antibody, Catalog Number: orb575215, Formalin Fixed Paraffin Embedded Tissue: Human Adult heart, Observed Staining: Cytoplasmic, Primary Antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy2/3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.
WB Suggested Anti-TRIM10 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: PANC1 cell lysate, There is BioGPS gene expression data showing that TRIM10 is expressed in PANC1.
WB Suggested Anti-TRIM10 antibody Titration: 1 ug/ml, Sample Type: Human heart.
WB Suggested Anti-TRIM10 antibody Titration: 1 ug/ml, Sample Type: Human liver.
WB | |
Animal, Bovine, Canine, Guinea pig, Human, Mouse, Porcine, Rabbit | |
Animal, Bovine, Canine, Guinea pig, Human, Mouse, Porcine | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating