TRIM10 antibody

• Catalog Number: orb575077
• Category: Antibodies
• Description: Rabbit polyclonal antibody to TRIM10
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Animal, Bovine, Canine, Guinea pig, Human, Mouse, Porcine, Rabbit
• Reactivity: Animal, Bovine, Canine, Guinea pig, Human, Mouse, Porcine
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human TRIM10
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 55kDa
• Target: TRIM10
• UniProt ID: Q9UDY6
• Protein Sequence: Synthetic peptide located within the following region: RVSLDYEVGWVTFTNAVTREPIYTFTASFTRKVIPFFGLWGRGSSFSLSS
• NCBI: NP_006769
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: RNF9, HERF1, RFB30
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Host: Rabbit, Target Name: TRIM10, Sample Tissue: Human PANC1 Whole Cell, Antibody dilution: 5 ug/ml.

Host: Rabbit, Target Name: TRIM10, Sample Type: 721_B, Antibody dilution: 1.0 ug/ml. There is BioGPS gene expression data showing that TRIM10 is expressed in 721_B.

Host: Rabbit, Target Name: TRIM10, Sample Type: Hela, Antibody dilution: 1.0 ug/ml.

Host: Rabbit, Target Name: TRIM10, Sample Type: Human Fetal Brain, Antibody dilution: 1.0 ug/ml.

Host: Rabbit, Target Name: TRIM10, Sample Type: Human Fetal Heart, Antibody dilution: 1.0 ug/ml.

Host: Rabbit, Target Name: TRIM10, Sample Type: Human Fetal Kidney, Antibody dilution: 1.0 ug/ml.

Host: Rabbit, Target Name: TRIM10, Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.

Host: Rabbit, Target Name: TRIM10, Sample Type: Jurkat, Antibody dilution: 1.0 ug/ml.

Host: Rabbit, Target Name: TRIM10, Sample Type: MCF7, Antibody dilution: 1.0 ug/ml.

WB Suggested Anti-TRIM10 Antibody Titration: 5.0 ug/ml, ELISA Titer: 1:2500, Positive Control: HepG2 cell lysate, There is BioGPS gene expression data showing that TRIM10 is expressed in HepG2.