Cart summary

You have no items in your shopping cart.

    TRI40 antibody

    Catalog Number: orb324582

    DispatchUsually dispatched within 1 - 2 weeks
    $ 572.00
    Catalog Numberorb324582
    CategoryAntibodies
    DescriptionRabbit polyclonal antibody to TRI40
    Species/HostRabbit
    ClonalityPolyclonal
    Tested applicationsWB
    Predicted ReactivityEquine, Rabbit, Rat
    ReactivityHuman
    ImmunogenThe immunogen is a synthetic peptide directed towards the C-terminal region of Human TRI40
    Concentration0.5 mg/ml
    Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
    ConjugationUnconjugated
    MW28kDa
    TargetTRIM40
    UniProt IDQ6P9F5
    Protein SequenceSynthetic peptide located within the following region: ISRAVTQLRSLVIDLERTAKELDTNTLKNAGDLLNRSAPQKLEVIYPQLE
    StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
    Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
    Alternative namesanti TRIM40 antibody, anti RNF35 antibody, anti an
    Read more...
    NoteFor research use only
    Expiration Date12 months from date of receipt.
    TRI40 antibody

    Host: Rabbit, Target Name: TRI40, Sample Type: Jurkat Whole Cell lysates, Antibody Dilution: 1 ug/mL.

    Submit a review

    Filter by Rating

      • Star
      • Star
      • Star
      • Star
      • Star
      • 5 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 4 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 3 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 2 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 1 stars