You have no items in your shopping cart.
Cart summary
Transthyretin (F87M/L110M), Human, Recombinant
Catalog Number: orb1401961
| Catalog Number | orb1401961 |
|---|---|
| Category | Proteins |
| Description | Transthyretin (TTR), formerly known as Prealbumin, is in vivo involved in the binding and transportation of the Thyroxin hormone and retinol-binding protein. Mutations in TTR are associated with familial amyloidotic polyneuropathy (FAP) which is a fatal disease characterized by amyloid depositions found in visceral organs including the heart, liver, and kidney. F87M/L110M TTR is an engineered variant unable to form a stable tetramer |
| Form/Appearance | Lyophilized |
| Purity | 95% by Chromatography and SDS-PAGE |
| MW | 13.7 kDa |
| Solubility (25°C) | The lyophilized protein is readily soluble in PBS pH 7.4. |
| Protein Sequence | GPTGTGESKCPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKALGISPMHEHAEVVFTANDSGPRRYTIAAMLSPYSYSTTAVVTNPKE |
| Source | Protein expressed in Escherichia coli |
| Storage | Store at -20°C upon arrival. |
| Buffer/Preservatives | The lyophilized protein is readily soluble in PBS pH 7.4 |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |
