TPR Antibody

• Catalog Number: orb1145797
• Category: Antibodies
• Description: TPR Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: FC, ICC, IF, IHC, WB
• Reactivity: Human, Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence of human TPR (AAVLQQVLERTELNKLPKSVQNKLEKFLADQQ).
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 267 kDa
• UniProt ID: P12270
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• Application notes: Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Expiration Date: 12 months from date of receipt.

IHC analysis of TPR using anti-TPR antibody. TPR was detected in a paraffin-embedded section of human colorectal cancer tissue.

IHC analysis of TPR using anti-TPR antibody. TPR was detected in a paraffin-embedded section of mouse brain tissue.

IHC analysis of TPR using anti-TPR antibody. TPR was detected in a paraffin-embedded section of rat brain tissue.

IF analysis of TPR using anti-TPR antibody. TPR was detected in an immunocytochemical section of SiHa cells.

IF analysis of TPR using anti-TPR antibody. TPR was detected in an immunocytochemical section of CACO-2 cells.

Western blot analysis of TPR using anti-TPR antibody.

Flow Cytometry analysis of Jurkat cells using anti-TPR antibody(Blue line).Isotype control antibody(Green line) was rabbit IgG.Unlabelled sample(Red line) was also used as a control.