You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb330545 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to TPD52 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Animal, Bovine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish |
Reactivity | Equine, Guinea pig, Human, Mouse, Rat, Zebrafish |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human TPD52 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 24kDa |
Target | TPD52 |
UniProt ID | P55327 |
Protein Sequence | Synthetic peptide located within the following region: AGQKASAAFSSVGSVITKKLEDVKNSPTFKSFEEKVENLKSKVGGTKPAG |
NCBI | NP_001020423 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti D52 antibody, anti N8L antibody, anti PC-1 an Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Western blot analysis of Jurkat cell lysate tissue using TPD52 antibody
Immunohistochemical staining of mouse retina tissue using TPD52 antibody
Application: Immunofluorescence, Species+tissue/cell type: Mouse retina, Primary antibody dilution: 1:200, Secondary antibody: Goat anti-rabbit Alexafluor 568, Secondary antibody dilution: 1:200.
WB Suggested Anti-TPD52 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Jurkat cell lysate, TPD52 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells.
IHC, WB | |
Animal, Bovine, Canine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish | |
Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat, Zebrafish | |
Rabbit | |
Polyclonal | |
Unconjugated |
IH, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating