TPCN1 antibody

• Catalog Number: orb575428
• Category: Antibodies
• Description: Rabbit polyclonal antibody to TPCN1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish
• Reactivity: Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rat, Zebrafish
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TPCN1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 94 kDa
• Target: TPCN1
• UniProt ID: Q9ULQ1
• Protein Sequence: Synthetic peptide located within the following region: YQEAAIYLQEGENNDKFFTHPKDAKALAAYLFAHNHLFYLMELATALLLL
• NCBI: NP_060371
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: TPC1
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.

Host: Rabbit, Target Name: TPCN1, Sample Tissue: Human 293T, Antibody dilution: 1.0 ug/ml.

Host: Rabbit, Target Name: TPCN1, Sample Tissue: Human 786-0 Whole Cell, Antibody dilution: 1 ug/ml.

Host: Rabbit, Target Name: TPCN1, Sample Type: HT1080, Antibody dilution: 1.0 ug/ml.

WB Suggested Anti-TPCN1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: HT1080 cell lysate.