You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb585241 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to TOMM70 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish |
Reactivity | Human |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 67kDa |
Target | TOMM70 |
UniProt ID | O94826 |
Protein Sequence | Synthetic peptide located within the following region: YLWSRQQRRREARGRGDASGLKRNSERKTPEGRASPAPGSGHPEGPGAHL |
NCBI | NP_055635 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | Tom70, TOMM70A Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
WB Suggested Anti-TOMM70A Antibody, Titration: 1.0 ug/ml, Positive Control: Hela Whole Cell. TOMM70A is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells.
ELISA, FC, ICC, IF, IHC, WB | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating