TOMM70 antibody

• Catalog Number: orb585241
• Category: Antibodies
• Description: Rabbit polyclonal antibody to TOMM70
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Reactivity: Human
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 67kDa
• Target: TOMM70
• UniProt ID: O94826
• Protein Sequence: Synthetic peptide located within the following region: YLWSRQQRRREARGRGDASGLKRNSERKTPEGRASPAPGSGHPEGPGAHL
• NCBI: NP_055635
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: Tom70, TOMM70A
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

WB Suggested Anti-TOMM70A Antibody, Titration: 1.0 ug/ml, Positive Control: Hela Whole Cell. TOMM70A is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells.