You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2285958 |
---|---|
Category | Proteins |
Description | Human TOMM20 full-length ORF ( AAH66335, 1 a.a. - 145 a.a.) recombinant protein with GST-tag at N-terminal. |
Clonality | Recombinant |
Tested applications | AP, Array, ELISA, WB |
Tag | GST |
Protein Sequence | MVGRNSAIAAGVCGALFIGYCIYFDRKRRSDPNFKNRLRERRKKQKLAKERAGLSKLPDLKDAEAVQKFFLEEIQLGEELLAQGEYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKLPTISQRIVSAQSLAEDDVE |
NCBI | AAH66335 |
Storage | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Buffer/Preservatives | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Note | For research use only |
Application notes | Best use within three months from the date of receipt of this protein. |
Expiration Date | 6 months from date of receipt. |
Filter by Rating