TNNI3 monoclonal antibody (M04), clone 1E7

• Catalog Number: orb2292040
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant TNNI3.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 1E7
• Tested applications: ELISA, IF, IHC-P, WB
• Reactivity: Human
• Isotype: IgG2a Kappa
• Immunogen: TNNI3 (NP_000354, 102 a.a. ~ 210 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: ARVDKVDEERYDIEAKVTKNITEIADLTQKIFDLRGKFKRPTLRRVRISADAMMQALLGARAKESLDLRAHLKQVKKEDTEKENREVGDWRKNIDALSGMEGRKKKFES
• NCBI: NP_000354
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged TNNI3 is 1 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to TNNI3 on HeLa cell. [antibody concentration 10 ug/ml]

Immunoperoxidase of monoclonal antibody to TNNI3 on formalin-fixed paraffin-embedded human heart. [antibody concentration 0.7 ug/ml]

Western Blot analysis of TNNI3 expression in transfected 293T cell line by TNNI3 monoclonal antibody (M04), clone 1E7. Lane 1: TNNI3 transfected lysate (24 KDa). Lane 2: Non-transfected lysate.

Western blot analysis of TNNI3 over-expressed 293 cell line, cotransfected with TNNI3 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with TNNI3 monoclonal antibody (M04), clone 1E7 (Cat # orb2292040). GAPDH (36.1 kDa) used as specificity and loading control.

Western Blot detection against Immunogen (37.73 KDa).