You have no items in your shopping cart.
Cart summary
TNFSF11 Peptide - middle region
Catalog Number: orb2000368
| Catalog Number | orb2000368 |
|---|---|
| Category | Proteins |
| Description | TNFSF11 Peptide - middle region |
| Predicted Reactivity | Human |
| Form/Appearance | Lyophilized powder |
| MW | 34 kDa |
| UniProt ID | O14788 |
| Protein Sequence | Synthetic peptide located within the following region: PFAHLTINATDIPSGSHKVSLSSWYHDRGWAKISNMTFSNGKLIVNQDGF |
| NCBI | NP_003692.1 |
| Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles. |
| Buffer/Preservatives | Lyophilized powder |
| Alternative names | ODF, OPGL, sOdf, CD254, OPTB2, RANKL, TNLG6B, TRAN Read more... |
| Note | For research use only |
| Application notes | This is a synthetic peptide designed for use in combination with TNFSF11 Rabbit Polyclonal Antibody (orb589525). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. |
| Expiration Date | 6 months from date of receipt. |
