TNFRSF1A antibody

• Catalog Number: orb592651
• Category: Antibodies
• Description: Rabbit polyclonal antibody to TNFRSF1A
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IF, WB
• Predicted Reactivity: Guinea pig, Mouse
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TNFRSF1A
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 50 kDa
• Target: TNFRSF1A
• UniProt ID: P19438
• Protein Sequence: Synthetic peptide located within the following region: MGLSTVPDLLLPLVLLELLVGIYPSGVIGLVPHLGDREKRDSVCPQGKYI
• NCBI: NP_001056
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: FPF, p55, p60, TBP1, TNF-R, TNFAR, TNFR1, p55-R, C
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. The protein is processed to ~48 kDa, a smaller isoform of 24 kDa also contains the peptide sequence, and the protein may also be glycosylated.

Host: Rabbit, Target Name: TNFRSF1A, Sample Tissue: Human A549 Whole Cell, Antibody Dilution: 1 ug/ml.

Host: Rabbit, Target Name: TNFRSF1A, Sample Tissue: Human Jurkat Whole Cell, Antibody Dilution: 1 ug/ml.

Host: Rabbit, Target: TNFRSF1A, Positive control (+): THP-1 (N30), Negative control (-): SH-SY5Y (N19), Antibody concentration: 1 ug/ml.

Immunofluorescent TNFRSF1A detection in human lymphocytes (green fluorescence). Nuclei were stained with DAPI (blue fluorescence), Working dilution 5-10 ug/ml.

WB Suggested Anti-TNFRSF1A Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: DU145 cell lysate. TNFRSF1A is supported by BioGPS gene expression data to be expressed in DU145.