Tnfrsf12a antibody

• Catalog Number: orb581350
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Tnfrsf12a
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat
• Reactivity: Mouse
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 14kDa
• Target: Tnfrsf12a
• UniProt ID: Q9CR75
• Protein Sequence: Synthetic peptide located within the following region: MASAWPRSLPQILVLGFGLVLMRAAAGEQAPGTSPCSSGSSWSADLDKCM
• NCBI: NP_038777
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: Fn1, Fn14, HPIP, Twea, TWEAK, C87282, TweakR, TWEA
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Host: Rabbit, Target Name: TNFRSF12A, Sample Tissue: Mouse Thymus, Antibody dilution: 1 ug/ml.

WB Suggested Anti-Tnfrsf12a Antibody, Titration: 1.0 ug/ml, Positive Control: Mouse Kidney.