You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb443147 |
---|---|
Category | Antibodies |
Description | TMEM16A/ANO1 Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | FC, IHC, WB |
Reactivity | Human |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence of human TMEM16A (QQIHKEK VLMVELFMREEQDKQQLLETWMEKERQKDE). |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 130 kDa |
UniProt ID | Q5XXA6 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | Anoctamin-1; Discovered on gastrointestinal stroma Read more... |
Note | For research use only |
Application notes | Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
Flow Cytometry analysis of A431 cells using anti-TMEM16A antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.
WB analysis of TMEM16A using anti-TMEM16A antibody.Lane 1:human HeLa Cell;2:human HepG2 Cell;3:human A549 Cell;4:human PANC-1 Cell;5:human SK-OV-3 Cell;6:human SGC-7901 Cell;7:human COLO-320 Cell.
IHC analysis of TMEM16A using anti-TMEM16A antibody.TMEM16A was detected in paraffin-embedded section of human oesophagus squama cancer tissues.
Filter by Rating