You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb327372 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to TMED7 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Human |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human TMED7 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 24kDa |
Target | TMED7 |
UniProt ID | Q9Y3B3 |
Protein Sequence | Synthetic peptide located within the following region: SALTQMESACVSIHEALKSVIDYQTHFRLREAQGRSRAEDLNTRVAYWSV |
NCBI | NP_861974 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti TMED7 antibody, anti CGI-109 antibody, anti a Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Western blot analysis of human Ovary Tumor tissue using TMED7 antibody
Host: Rabbit, Target Name: TMED7, Sample Type: Ovary Tumor lysates, Antibody Dilution: 1.0 ug/mL.
WB | |
Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish | |
Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating