You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb579880 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to Tmed1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Zebrafish |
Reactivity | Human, Rat |
Immunogen | The immunogen is a synthetic peptide corresponding to a region of Rat |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 25kDa |
Target | Tmed1 |
UniProt ID | Q5BK85 |
Protein Sequence | Synthetic peptide located within the following region: EAGPPPIQDGEFTFLLPAGRKQCFYQSAPANASLETEYQVIGGAGLDVDF |
NCBI | NP_001013450 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | Il1rl1l Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Lanes: Lane 1 and 2: 30 ug HEK-293 cell lysate, Primary Antibody dilution: 1:1000, Secondary Antibody: Anti-Rabbit HRP, Secondary Antibody dilution: 1:2000, Gene Name: Tmed1.
Rabbit Anti-Tmed1 Antibody, Catalog Number: orb579880, Formalin Fixed Paraffin Embedded Tissue: Human Adult heart, Observed Staining: Cytoplasmic (resembles Golgi), Primary Antibody Concentration: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy2/3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec, Protocol located in Reviews and Data.
WB Suggested Anti-Tmed1 antibody Titration: 1 ug/ml, Sample Type: Human heart.
WB Suggested Anti-Tmed1 antibody Titration: 1 ug/ml, Sample Type: Human liver.
WB Suggested Anti-Tmed1 Antibody, Titration: 1.0 ug/ml, Positive Control: Rat Lung.
ELISA, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Zebrafish | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating