You have no items in your shopping cart.
Cart summary
Item 1 of 10
Item 1 of 10
| Catalog Number | orb573647 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to TLR2 |
| Species/Host | Rabbit |
| Clonality | Polyclonal |
| Tested applications | IF, IHC-P, WB |
| Predicted Reactivity | Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rat, Sheep, Zebrafish |
| Reactivity | Human |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human TLR2 |
| Concentration | 0.5 mg/ml |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Conjugation | Unconjugated |
| MW | 90 kDa |
| Target | TLR2 |
| UniProt ID | O60603 |
| Protein Sequence | Synthetic peptide located within the following region: LEPIEKKAIPQRFCKLRKIMNTKTYLEWPMDEAQREGFWVNLRAAIKS |
| NCBI | NP_003255 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Alternative names | TIL4, CD282 Read more... |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |
Filter by Applications
B. Sayyaf Dezfuli a, F. Pironi a, G. Castaldelli b, L. Giari b, M. Lanzoni b, K. Buchmann c, P.W. Kania c, G. Bosi Anguilla anguilla vs Contracaecum rudolphii: Granuloma allows host tolerance and parasite survival Aquaculture, (2024)
Applications
IHC
Sample Type: Human Macrophange Cells, Green: primary, Red: phallodin, Blue: DAPI, Yellow: green/red, Primary dilution: 1:200, Secondary Antibody: anti-Rabbit IgG-FITC, Secondary dilution: 1:1000.
25 ug of the indicated Human whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 0.05 ug/ml of the antibody was used in this experiment. An isoform containing the peptide sequence is present at 23 kDa.
Sample Tissue: Human Lung Tumor, Antibody dilution: 1 ug/ml.
Sample Tissue: Human OVCAR-3, Antibody dilution: 1.0 ug/ml.
Sample Type: 786-0 Whole Cell lysates, Antibody dilution: 0.05 ug/ml.
IF Information: human macrophages.
IHC Information: Lung.
Immunohistochemistry with Liver tissue at an antibody concentration of 5.0 ug/ml using anti-TLR2 antibody (orb573647).
Immunohistochemistry with pFA fixed human thymus tissue.
TLR2 antibody - C-terminal region (orb573647) validated by WB using Fetal Brain Lysate at 1 ug/ml.
- Item 1 of 2
TLR2 Rabbit Polyclonal Antibody [orb11487]
IF, IHC-Fr, IHC-P, WB
Bovine, Canine, Gallus, Mouse, Porcine, Sheep
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
100 μl, 200 μl, 50 μl - Item 1 of 6
- Item 1 of 6
- Item 1 of 6
- Item 1 of 6
