TKTL1 antibody

• Catalog Number: orb582178
• Category: Antibodies
• Description: Rabbit polyclonal antibody to TKTL1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TKTL1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 65kDa
• Target: TKTL1
• UniProt ID: P51854
• Protein Sequence: Synthetic peptide located within the following region: QIQTSRNLDPQPPIEDSPEVNITDVRMTSPPDYRVGDKIATRKACGLALA
• NCBI: NP_036385
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: TKR, TKT2
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Immunohistochemistry with Human Testis lysate tissue at an antibody concentration of 5.0 ug/ml using anti-TKTL1 antibody (orb582178).

WB Suggested Anti-TKTL1 Antibody Titration: 1 ug/ml, Positive Control: Fetal Stomach cell lysate.