You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb330155 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to TIA1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Equine, Guinea pig, Mouse, Rabbit, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human TIA1 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 42 kDa |
Target | TIA1 |
UniProt ID | P31483 |
Protein Sequence | Synthetic peptide located within the following region: QAWNQQGFNQTQSSAPWMGPNYGVQPPQGQNGSMLPNQPSGYRVAGYETQ |
NCBI | NP_071320 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti TIA-1 antibody Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
50 ug HAP1 WT and TIA1 KO lysates were subjected to SDS-PAGE followed by immunoblotting with an antibody dilution of 1/200. (right) Ponceau S staining to verify protein transfer.
HAP1 WT and TIA1 KO cells were labelled with a green or a far-red fluorescent dye, respectively. WT and KO cells were mixed and plated to a 1:1 ratio in a 96-well plate as a mosaic culture. Cells were stained with orb330155 at a dilution of 1/500. Bars = 10um.
TIA1 was immunoprecipitated from 2 mg HEK293 Whole Cell Lysate with orb330155 with 1:200 dilution. Western blot was performed using orb330155 at 1/1000 dilution, Lane 1: Control IP in HEK293 Whole Cell Lysate, Lane 2: TIA1 IP with orb330155 in HEK293 Whole Cell Lysate, Lane 3: Input of HEK293 Whole Cell Lysate.
TIA1 was immunoprecipitated from HAP1 WT cell lysates using 1 ug of orb330155 coupled to Dynabeads. The Ponceau stained transfers of each blot are shown. SM=4% starting material; UB=4% unbound fraction; IP=immunoprecipitated.
WB Suggested Anti-TIA1 Antibody Titration: 0.2-1 ug/mL, Positive Control: Human Thymus.
ELISA, IF, IHC, WB | |
Canine, Human, Mouse, Rat | |
Goat | |
Polyclonal | |
Unconjugated |
ELISA, IF, IHC, WB | |
Canine, Mouse, Rat | |
Human | |
Goat | |
Polyclonal | |
Unconjugated |
IF, WB | |
Human | |
Mouse | |
Monoclonal | |
Unconjugated |
Filter by Rating