You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb578339 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to TGM4 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Guinea pig, Mouse, Rat, Zebrafish |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human TGM4 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 77kDa |
Target | TGM4 |
UniProt ID | P49221 |
Protein Sequence | Synthetic peptide located within the following region: KEDMVFMPDEDERKEYILNDTGCHYVGAARSIKCKPWNFGQFEKNVLDCC |
NCBI | NP_003232 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | TGP, hTGP Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
TGM4 antibody - N-terminal region (orb578339), Sample Type: Normal Human Prostate, Primary Antibody Dilution: 2 ug/ml, Color/Signal Descriptions: TGM4 (DAB; brown), nuclei (hematoxylin; blue), Gene Name: TGM4.
TGM4 antibody - N-terminal region (orb578339), Sample Type: Normal Human Prostate, Primary Antibody Dilution: 2 ug/ml, Color/Signal Descriptions: TGM4 (DAB; brown), nuclei (hematoxylin; blue), Gene Name: TGM4.
Sample Type: Normal Human Prostate. Primary Antibody Dilution: 2 ug/ml. Color/Signal Descriptions: TGM4 (DAB; brown), nuclei (hematoxylin; blue), Gene Name: TGM4.
WB Suggested Anti-TGM4 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: OVCAR-3 cell lysate. TGM4 is strongly supported by BioGPS gene expression data to be expressed in Human OVCAR3 cells.
Filter by Rating