You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb763093 |
---|---|
Category | Antibodies |
Description | TGFBR2 Antibody (monoclonal, 2F11) |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 2F11 |
Tested applications | FC, ICC, IF, IHC, WB |
Reactivity | Human |
Isotype | Mouse IgG2b |
Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human TGFBR2 (96-128aa TLETVCHDPKLPYHDFILEDAASPKCIMKEKKK), different from the related mouse sequence by five amino acids, and from the related rat sequence by eight amino acids. |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 70-85 kDa |
UniProt ID | P37173 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Note | For research use only |
Application notes | Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
Western blot analysis of TGFBR2 using anti-TGFBR2 antibody (orb763093). Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel)/90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30ug of sample under reducing conditions. Lane 1: human HepG2 whole cell lysates, Lane 2: human A549 whole cell lysates, Lane 3: human K562 whole cell lysates, Lane 4: human Caco-2 whole cell lysates, Lane 5: human HeLa whole cell lysates, Lane 6: human T-47D whole cell lysates. After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/TBS for 1.5 hour at RT. The membrane was incubated with mouse anti-TGFBR2 antigen affinity purified monoclonal antibody (Catalog # orb763093) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-mouse IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # orb90502) with Tanon 5200 system. A specific band was detected for TGFBR2 at approximately 70-85KD. The expected band size for TGFBR2 is at 70-85KD.
IHC analysis of TGFBR2 using anti-TGFBR2 antibody (orb763093). TGFBR2 was detected in paraffin-embedded section of human placenta tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2μg/ml mouse anti-TGFBR2 Antibody (orb763093) overnight at 4°C. Biotinylated goat anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # orb90443) with DAB as the chromogen.
IHC analysis of TGFBR2 using anti-TGFBR2 antibody (orb763093). TGFBR2 was detected in paraffin-embedded section of human cervical intraepithelial neoplasia tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2μg/ml mouse anti-TGFBR2 Antibody (orb763093) overnight at 4°C. Biotinylated goat anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # orb90443) with DAB as the chromogen.
IHC analysis of TGFBR2 using anti-TGFBR2 antibody (orb763093). TGFBR2 was detected in paraffin-embedded section of human esophageal squamous carcinoma tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2μg/ml mouse anti-TGFBR2 Antibody (orb763093) overnight at 4°C. Biotinylated goat anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # orb90443) with DAB as the chromogen.
IF analysis of TGFBR2 using anti-TGFBR2 antibody (orb527054). TGFBR2 was detected in immunocytochemical section of HepG2 cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent (orb90553) for 15 mins. The cells were blocked with 10% goat serum. And then incubated with 5μg/mL mouse anti-TGFBR2 Antibody (orb527054) overnight at 4°C. DyLight®488 Conjugated Goat Anti-Mouse IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.
Flow Cytometry analysis of A549 cells using anti-TGFBR2 antibody (orb763093). Overlay histogram showing A549 cells stained with orb763093 (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with mouse anti-TGFBR2 Antibody (orb763093, 1μg/1x10^6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-mouse IgG (5-10μg/1x10^6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was mouse IgG (1μg/1x10^6) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
FC, ICC, IF, IHC, WB | |
Human | |
Mouse | |
Monoclonal | |
Unconjugated |
Filter by Rating