TGFBR1 polyclonal antibody (A01)

• Catalog Number: orb2292059
• Category: Antibodies
• Description: Mouse polyclonal antibody raised against a partial recombinant TGFBR1.
• Species/Host: Mouse
• Clonality: Polyclonal
• Tested applications: ELISA, WB
• Reactivity: Human, Rat
• Immunogen: TGFBR1 (NP_004603, 30 a.a. ~ 125 a.a) partial recombinant protein with GST tag.
• Conjugation: Unconjugated
• Protein Sequence: GATALQCFCHLCTKDNFTCVTDGLCFVSVTETTDKVIHNSMCIAEIDLIPRDRPFVCAPSSKTGSVTTTYCCNQDHCNKIELPTTVKSSPGLGPVE
• NCBI: NP_004603
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: 50 % glycerol
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

TGFBR1 polyclonal antibody (A01), Western Blot analysis of TGFBR1 expression in HepG2.

TGFBR1 polyclonal antibody (A01), Western Blot analysis of TGFBR1 expression in Hs 181.Tes.

TGFBR1 polyclonal antibody (A01), Western Blot analysis of TGFBR1 expression in human spleen.

TGFBR1 polyclonal antibody (A01), Western Blot analysis of TGFBR1 expression in RIN-m5F.

Western Blot detection against Immunogen (36.67 KDa).