You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb324785 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to TGFB1I1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Animal, Canine, Human, Mouse, Rabbit, Rat |
Reactivity | Canine, Equine, Human, Mouse, Rat |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human TGFB1I1 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 48kDa |
Target | TGFB1I1 |
UniProt ID | B2R8D5 |
Protein Sequence | Synthetic peptide located within the following region: PRSGAPKERPAEPLTPPPSYGHQPQTGSGESSGASGDKDHLYSTVCKPRS |
NCBI | NP_057011 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti ARA55 antibody, anti HIC-5 antibody, anti HIC Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Western blot analysis of Transfected 293T tissue using TGFB1I1 antibody
Immunohistochemical staining of human Tonsil tissue using TGFB1I1 antibody
Immunohistochemistry with Human Tonsil lysate tissue at an antibody concentration of 5.0 ug/mL using anti-TGFB1I1 antibody (orb324785).
WB Suggested Anti-TGFB1I1 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: Transfected 293T.
IHC, WB | |
Animal, Bovine, Canine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat | |
Canine, Equine, Goat, Guinea pig, Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IF, IHC-P, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating