TFEB antibody

• Catalog Number: orb333116
• Category: Antibodies
• Description: Rabbit polyclonal antibody to TFEB
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Animal, Bovine, Canine, Goat, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat
• Reactivity: Canine, Equine, Goat, Guinea pig, Human, Mouse, Porcine, Rat
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TFEB
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 53 kDa
• Target: TFEB
• UniProt ID: P19484
• Protein Sequence: Synthetic peptide located within the following region: IKELGMLIPKANDLDVRWNKGTILKASVDYIRRMQKDLQKSRELENHSRR
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: TCFEB, BHLHE35, ALPHATFEB
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western blot analysis of HepG2 cell lysate tissue using TFEB antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 0.5 ug/ml of the antibody was used in this experiment.

Host: Rabbit, Target Name: TFEB, Sample Tissue: Human Lung Tumor, Antibody dilution: 1.0 ug/ml.

WB Suggested Anti-TFEB Antibody Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate.