TFEB antibody

• Catalog Number: orb330957
• Category: Antibodies
• Description: Rabbit polyclonal antibody to TFEB
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Animal, Bovine, Canine, Goat, Human, Rabbit
• Reactivity: Canine, Equine, Goat, Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TFEB
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 53kDa
• Target: TFEB
• UniProt ID: P19484
• Protein Sequence: Synthetic peptide located within the following region: DFSHSLSFGGREDEGPPGYPEPLAPGHGSPFPSLSKKDLDLMLLDDSLLP
• NCBI: NP_009093
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti AlphaTFEB antibody, anti TCFEB antibody, anti
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western blot analysis of human Fetal Heart tissue using TFEB antibody

Western blot analysis of PANC1 cell lysate tissue using TFEB antibody

Western blot analysis of human Placenta tissue using TFEB antibody

Western blot analysis of human Fetal Muscle tissue using TFEB antibody

Host: Rabbit, Target Name: TFEB, Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml.

Host: Rabbit, Target Name: TFEB, Sample Type: Human Fetal Heart, Antibody dilution: 1.0 ug/ml.

Host: Rabbit, Target Name: TFEB, Sample Type: Human Fetal Muscle, Antibody dilution: 1.0 ug/ml.

WB Suggested Anti-TFEB Antibody Titration: 0.2-1 ug/ml, Positive Control: PANC1 cell lysate.