You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb573720 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to TFCP2 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human TFCP2 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 57kDa |
Target | TFCP2 |
UniProt ID | Q12800 |
Protein Sequence | Synthetic peptide located within the following region: YSMSDVLALPIFKQEESSLPPDNENKILPFQYVLCAATSPAVKLHDETLT |
NCBI | NP_005644 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | LSF, SEF, LBP1C, LSF1D, TFCP2C Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Rabbit, Target: TFCP2, Positive control (+): 293T Cell Lysate (2T), Negative control (-): HeLa Cell Lysate (HL), Antibody concentration: 1 ug/ml.
Rabbit Anti-TFCP2 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Tonsil, Primary antibody Concentration: 1:200, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.
TFCP2 was immunoprecipitated from 1 mg HEK293 Whole Cell Lysate with orb573720 with 1:200 dilution. Western blot was performed using orb573720 at 1/1000 dilution. Lane 1: Control IP in HEK293 Whole Cell Lysate, Lane 2: TFCP2 IP with orb573720 in HEK293 Whole Cell Lysate, Lane 3: Input of HEK293 Whole Cell Lysate.
WB Suggested Anti-TFCP2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: 293T cell lysate.
WB | |
Bovine, Canine, Equine, Gallus, Rat | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating