You have no items in your shopping cart.
Cart summary
TES-26 Protein, Toxocara canis, Recombinant (His & SUMO)
Catalog Number: orb1976291
| Catalog Number | orb1976291 |
|---|---|
| Category | Proteins |
| Description | Binds phosphatidylethanolamine. TES-26 Protein, Toxocara canis, Recombinant (His & SUMO) is expressed in E. coli expression system with N-6xHis-SUMO tag. The predicted molecular weight is 41.9 kDa and the accession number is P54190. |
| Tag | N-6xHis-SUMO |
| Purity | 98.00% |
| MW | 41.9 kDa (predicted) |
| UniProt ID | P54190 |
| Protein Sequence | QCMDSASDCAANAGSCFTRPVSQVLQNRCQRTCNTCDCRDEANNCAASINLCQNPTFEPLVRDRCQKTCGLCAGCGFISSGIVPLVVTSAPSRRVSVTFANNVQVNCGNTLTTAQVANQPTVTWEAQPNDRYTLIMVDPDFPSAANGQQGQRLHWWVINIPGNNIAGGTTLAAFQPSTPAANTGVHRYVFLVYRQPAAINSPLLNNLVVQDSERPGFGTTAFATQFNLGSPYAGNFYRSQA |
| Expression System | E. coli |
| Biological Origin | Toxocara canis |
| Biological Activity | Binds phosphatidylethanolamine. TES-26 Protein, Toxocara canis, Recombinant (His & SUMO) is expressed in E. coli expression system with N-6xHis-SUMO tag. The predicted molecular weight is 41.9 kDa and the accession number is P54190. |
| Expression Region | 22-262 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Expiration Date | 6 months from date of receipt. |
