You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb574665 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to Tead4 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish |
Reactivity | Human, Mouse |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 48kDa |
Target | Tead4 |
UniProt ID | Q62296 |
Protein Sequence | Synthetic peptide located within the following region: RRKAREIQAKLKDQAAKNKALQSMAAMSSAQIVSATAFHSKMALARGPGY |
NCBI | NP_035697 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | Tef, Etfr, Rtef, Tef3, Tefr, ETFR-, Etfr2, FR-19, Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
WB Suggested Anti-Tead4 antibody Titration: 1 ug/ml, Sample Type: Human heart.
WB Suggested Anti-Tead4 antibody Titration: 1 ug/ml, Sample Type: Human liver.
WB Suggested Anti-Tead4 Antibody, Titration: 1.0 ug/ml, Positive Control: Mouse Intestine.
IHC, WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
ICC, IHC-P, WB | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC, WB | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating