TEAD1 antibody

• Catalog Number: orb577162
• Category: Antibodies
• Description: Rabbit polyclonal antibody to TEAD1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human TEAD1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 46kDa
• Target: TEAD1
• UniProt ID: P28347
• Protein Sequence: Synthetic peptide located within the following region: YMMNSVLENFTILLVVTNRDTQETLLCMACVFEVSNSEHGAQHHIYRLVK
• NCBI: NP_068780
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: AA, REF1, TCF13, TEF-1, NTEF-1, TCF-13, TEAD-1
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Host: Rabbit, Target Name: TEAD1, Antibody Dilution: 1.0 ug/ml, Sample Type: Human Placenta.

Host: Rabbit, Target Name: TEAD1, Sample Type: Human Fetal Muscle, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/ml, Peptide Concentration: 5 ug/ml, Lysate Quantity: 25 ug/lane/lane, Gel Concentration: 0.12.

Host: Rabbit, Target Name: WT1, Sample Type: 721_B, Antibody Dilution: 1.0 ug/ml. TEAD1 is supported by BioGPS gene expression data to be expressed in 721_B.

Rabbit Anti-TEAD1 antibody, Paraffin Embedded Tissue: Human Lung, cell Cellular Data: alveolar cell, Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X.