You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb579554 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to TDO2 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human TDO2 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 48 kDa |
Target | TDO2 |
UniProt ID | P48775 |
Protein Sequence | Synthetic peptide located within the following region: LFIITHQAYELWFKQILWELDSVREIFQNGHVRDERNMLKVVSRMHRVSV |
NCBI | NP_005642 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | TO, TDO, TPH2, TRPO, HYPTRP Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.
Host: Rabbit, Target Name: TDO2, Sample Tissue: Human HepG2 Whole Cell, Antibody dilution: 1 ug/ml.
Host: Rabbit, Target Name: TDO2, Sample Tissue: Human Liver Tumor, Antibody dilution: 1 ug/ml.
Host: Rabbit, Target Name: TDO2, Sample Tissue: Human Ovary Tumor, Antibody dilution: 1 ug/ml.
WB Suggested Anti-TDO2 Antibody Titration: 0.2-1 ug/ml, Positive Control: Human Small Intestine.
Filter by Rating