TCTN3 antibody

• Catalog Number: orb579244
• Category: Antibodies
• Description: Rabbit polyclonal antibody to TCTN3
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TCTN3
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 64kDa
• Target: TCTN3
• UniProt ID: Q6NUS6
• Protein Sequence: Synthetic peptide located within the following region: LTYFPKWSVISLLRQPAGVGAGGLCAESNPAGFLESKSTTCTRFFKNLAS
• NCBI: NP_056446
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: OFD4, TECT3, JBTS18, C10orf61
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Host: Rabbit, Target Name: TCTN3, Sample Type: Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.

Rabbit Anti-TCTN3 Antibody, Catalog Number: orb579244, Formalin Fixed Paraffin Embedded Tissue: Human Liver Tissue, Observed Staining: Plasma membrane and cytoplasm in hepatocytes, Primary Antibody Concentration: N/A, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-TCTN3 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: 721_B cell lysate. TCTN3 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.