You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb326525 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to TCL1B |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Human |
Reactivity | Human |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 15kDa |
Target | TCL1B |
UniProt ID | O95988 |
Protein Sequence | Synthetic peptide located within the following region: NPSRREWARASQGSRYEPSITVHLWQMAVHTRELLSSGQMPFSQLPAVWQ |
NCBI | NP_004909 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti TML1 antibody Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Western blot analysis of human MCF-7 tissue using TCL1B antibody
Host: Rabbit, Target Name: TCL1B, Antibody Dilution: 1.0 ug/mL, Sample Type: MCF7 cell lysate.
IF, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating