TCFL5 antibody

• Catalog Number: orb573825
• Category: Antibodies
• Description: Rabbit polyclonal antibody to TCFL5
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rat
• Reactivity: Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rat
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TCFL5
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 53kDa
• Target: TCFL5
• UniProt ID: Q9UL49
• Protein Sequence: Synthetic peptide located within the following region: TLIRHPSELMNVPLQQQNKCTALVKNKTAATTTALQFTYPLFTTNACSTS
• NCBI: NP_006593
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: CHA, Figlb, SOSF1, E2BP-1, bHLHe82
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Human kidney

WB Suggested Anti-TCFL5 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: HepG2 cell lysate, TCFL5 is supported by BioGPS gene expression data to be expressed in HepG2.