TCF4 antibody

• Catalog Number: orb592875
• Category: Antibodies
• Description: Rabbit polyclonal antibody to TCF4
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Equine, Guinea pig, Mouse, Porcine, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TCF4
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 71 kDa
• Target: TCF4
• UniProt ID: P15884
• Protein Sequence: Synthetic peptide located within the following region: DGTPYDHMTSRDLGSHDNLSPPFVNSRIQSKTERGSYSSYGRESNLQGCH
• NCBI: NP_003190
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: E2-2, ITF2, PTHS, SEF2, CDG2T, FECD3, ITF-2, SEF-2
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment.

Host: Rabbit, Target Name: TCF4, Sample Tissue: Human HCT116 Whole Cell, Antibody Dilution: 1 ug/ml.

TCF4 antibody - N-terminal region (orb592875) validated by WB using 1. SHSY-5Y lysate (15 ug) at 1:100, sH-SY5Y cell lysate;no + transfected hTCF4;yes (human neuroblastoma cells).

WB Suggested Anti-TCF4 Antibody, Titration: 0.2-1 ug/ml, Positive Control: HepG2.